PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G021200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 26909.8 Da    PI: 8.4426
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G021200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.48.9e-29959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien s rqvtfskRr g++KKA+ELSvLCdaeva+i+fs++++lye++s
  Brast02G021200.1.p  9 KRIENPSSRQVTFSKRRGGLMKKAYELSVLCDAEVALIVFSPRDRLYEFAS 59
                        79***********************************************86 PP

2K-box70.65e-2477170598
               K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                         ++ ++++++ e+ + +++ L +++e L+   R++lGe+L+++s++eLq+Le ++eksl +iR kK++l+ +q+++l++ke  l+++n++Lr
  Brast02G021200.1.p  77 TSIQTAQQDIEKVKANAEGLSQKLEALEAYRRKFLGEKLDDCSFEELQSLEVKIEKSLHSIRRKKTQLFEDQLSKLRQKEMTLRKDNEDLR 167
                         33447889999*******************************************************************************9 PP

               K-box  96 kkl 98 
                          k+
  Brast02G021200.1.p 168 GKV 170
                         886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.628161IPR002100Transcription factor, MADS-box
CDDcd002658.03E-39370No hitNo description
PRINTSPR004042.1E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-31377IPR002100Transcription factor, MADS-box
PfamPF003195.6E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-293859IPR002100Transcription factor, MADS-box
PfamPF014863.1E-2582170IPR002487Transcription factor, K-box
PROSITE profilePS5129712.98586176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009838Biological Processabscission
GO:0009909Biological Processregulation of flower development
GO:0010150Biological Processleaf senescence
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MVRGKTQLKR IENPSSRQVT FSKRRGGLMK KAYELSVLCD AEVALIVFSP RDRLYEFASA  60
GMQKTLERYK ASTKDKTSIQ TAQQDIEKVK ANAEGLSQKL EALEAYRRKF LGEKLDDCSF  120
EELQSLEVKI EKSLHSIRRK KTQLFEDQLS KLRQKEMTLR KDNEDLRGKV PKDGENVDLQ  180
GKCKDVVDLT LVTSAPMIVA AAAAEEEENP PQAQPELNKD AMDVETELFI GLPGTNRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A1e-21371270Myocyte-specific enhancer factor 2A
3mu6_B1e-21371270Myocyte-specific enhancer factor 2A
3mu6_C1e-21371270Myocyte-specific enhancer factor 2A
3mu6_D1e-21371270Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00576DAPTransfer from AT5G62165Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693080.0KF469308.1 Brachypodium distachyon MADS-box transcription factor 13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289808.11e-131MADS-box transcription factor 50-like
SwissprotQ9XJ606e-98MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLI1HAD01e-131I1HAD0_BRADI; MADS-box transcription factor 13
STRINGBRADI1G77020.11e-130(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.34e-63AGAMOUS-like 42